Cytochrome b245 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03403

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytochrome b245 alpha Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human Cytochrome b245 alpha (NP_000092.2). VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cytochrome b245 alpha Antibody - BSA Free

Cytochrome b245 alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] -

Immunocytochemistry/ Immunofluorescence: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] - Immunofluorescence analysis of MCF7 cells using Cytochrome b245 alpha Rabbit pAb (A10694) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Cytochrome b245 alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] -

Immunocytochemistry/ Immunofluorescence: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] - Immunofluorescence analysis of PC-12 cells using Cytochrome b245 alpha Rabbit pAb (A10694) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Cytochrome b245 alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] -

Immunocytochemistry/ Immunofluorescence: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] - Immunofluorescence analysis of NIH/3T3 cells using Cytochrome b245 alpha Rabbit pAb (A10694) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Cytochrome b245 alpha Antibody - BSA Free

Western Blot: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] -

Western Blot: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] - Western blot analysis of RAW264.7, using Cytochrome b245 alpha antibody (A10694) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Cytochrome b245 alpha Antibody - BSA Free

Western Blot: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] -

Western Blot: Cytochrome b245 alpha Antibody - BSA Free [NBP3-03403] - Western blot analysis of Rat lung, using Cytochrome b245 alpha antibody (A10694) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Applications for Cytochrome b245 alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytochrome b245 alpha

Alternate Names

cytochrome b light chain, Cytochrome b(558) alpha chain, cytochrome b(558) alpha-subunit, cytochrome b, alpha polypeptide, cytochrome b-245 light chain, cytochrome b-245, alpha polypeptide, Cytochrome b558 subunit alpha, flavocytochrome b-558 alpha polypeptide, Neutrophil cytochrome b 22 kDa polypeptide, p22 phagocyte B-cytochrome, p22phox, p22-PHOX, Superoxide-generating NADPH oxidase light chain subunit

Gene Symbol

CYBA

Additional Cytochrome b245 alpha Products

Product Documents for Cytochrome b245 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytochrome b245 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome b245 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytochrome b245 alpha Antibody - BSA Free and earn rewards!

Have you used Cytochrome b245 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies