Cytochrome P450 2B6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57140

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytochrome P450 2B6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EAQCLIEELRKSKGALVDPTFLFHSITANIICSI

Reactivity Notes

Mouse 82%, Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytochrome P450 2B6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cytochrome P450 2B6 Antibody [NBP2-57140]

Immunocytochemistry/ Immunofluorescence: Cytochrome P450 2B6 Antibody [NBP2-57140]

Immunocytochemistry/Immunofluorescence: Cytochrome P450 2B6 Antibody [NBP2-57140] - Staining of human cell line HaCaT shows localization to nuclear membrane & cytosol.

Applications for Cytochrome P450 2B6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome P450 2B6

The Cytochrome P450 2B6 gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot

Long Name

Cytochrome P450 2B6

Alternate Names

CYP2B6, CYPIIB6, EC 1.14.13.-

Gene Symbol

CYP2B6

Additional Cytochrome P450 2B6 Products

Product Documents for Cytochrome P450 2B6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytochrome P450 2B6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome P450 2B6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytochrome P450 2B6 Antibody - BSA Free and earn rewards!

Have you used Cytochrome P450 2B6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies