Cytohesin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68764

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytohesin 2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytohesin 2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cytohesin 2 Antibody [NBP2-68764]

Immunocytochemistry/ Immunofluorescence: Cytohesin 2 Antibody [NBP2-68764]

Immunocytochemistry/Immunofluorescence: Cytohesin 2 Antibody [NBP2-68764] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Applications for Cytohesin 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytohesin 2

Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with ARF1, ARF3, and ARF6. PSCD2 protein is 83% homologous to PSCD1. Two transcript variants encoding different isoforms have been found for this gene.

Long Name

Cytohesin-2

Alternate Names

ARF exchange factor, ARNO, CYTH2, Protein ARNO, PSCD2, PSCD2L

Gene Symbol

CYTH2

Additional Cytohesin 2 Products

Product Documents for Cytohesin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytohesin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytohesin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytohesin 2 Antibody - BSA Free and earn rewards!

Have you used Cytohesin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies