Dkk-2 Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-78529

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all Dkk-2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for Dkk-2 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Dkk-2

Analysis of individual DKK domains and chimeric DKKs shows that the carboxy-terminal domains of both DKK1 and DKK2 associate with LRP6 and are necessary and sufficient for Wnt8 inhibition. Xenopus Dickkopf 1 (DKK1) was initially discovered as a Wnt antagonist that plays an important role in head formation. By far, four members of DKK have been identified in mammals. Each DKK molecule contains two conserved cysteine-rich domains. Recent studies showed that the second Cys-rich domains of DKK1 and DKK2 inhibited Wnt3a-activated signaling, whereas the first Cys-rich domains had no effects. In addition, the second Cys-rich domain of DKK2, but not that of DKK1, was able to activate the canonical pathway in the presence of LRP6, and this LRP-dependent signaling does not require Dvl.

Long Name

Dickkopf-2

Alternate Names

Dkk2

Gene Symbol

DKK2

Additional Dkk-2 Products

Product Documents for Dkk-2 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dkk-2 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dkk-2 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review Dkk-2 Antibody [Biotin] and earn rewards!

Have you used Dkk-2 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies