DLG7/HURP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24790

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DLG7/HURP Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein DLG7/HURP using the following amino acid sequence: QTRLLMKERFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DLG7/HURP Antibody - BSA Free

DLG7/HURP Antibody Immunocytochemistry/Immunofluorescence: DLG7/HURP Antibody [NBP3-24790]

Immunocytochemistry/Immunofluorescence: DLG7/HURP Antibody [NBP3-24790]

Staining of human cell line HAP1 shows localization to cytosol & mitotic spindle.

Applications for DLG7/HURP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DLG7/HURP

DLG7/HURP is a novel component of the Ran-importin spindle assembly pathway. DLG7/HURP binds microtubules and affects their organization both in vitro and in vivo. In egg extract, anti-DLG7/HURP antibodies disrupt the formation of both Ran-dependent and chromatin and centrosome-induced spindles. DLG7/HURP is also required for the proper formation and function of mitotic spindles in HeLa cells. DLG7/HURP is also over-expressed in some tumor types

Alternate Names

DAP-5, Discs large homolog 7, discs, large (Drosophila) homolog-associated protein 5, disks large-associated protein 5, DLG7, Hepatoma up-regulated protein, HURPDLG1, KIAA0008discs, large homolog 7 (Drosophila), large homolog 7

Gene Symbol

DLGAP5

Additional DLG7/HURP Products

Product Documents for DLG7/HURP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DLG7/HURP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DLG7/HURP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DLG7/HURP Antibody - BSA Free and earn rewards!

Have you used DLG7/HURP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies