DNAJC8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55251

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNAJC8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EGSRGGWAGEMAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTDEEIK

Reactivity Notes

Mouse 87%, Rat 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJC8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DNAJC8 Antibody [NBP2-55251]

Immunocytochemistry/ Immunofluorescence: DNAJC8 Antibody [NBP2-55251]

Immunocytochemistry/Immunofluorescence: DNAJC8 Antibody [NBP2-55251] - Staining of human cell line HeLa shows localization to nucleoplasm, cytosol & cytokinetic bridge.

Applications for DNAJC8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJC8

DjC8 (DnaJ subfamily C member 8) belongs to the Hsp40 (heat shock protein 40) family of proteins that function as co-chaperones to Hsp70.Hsp40 proteins are classified into 3 main subfamilies (A, B, and C). The families are defined by the presence of particular domains which include a highly conserved alpha-helical N-terminal domain termed the J-domain, a glycine/phenylalanine-rich region, a cysteine-rich region, and a C-terminal beta-sheet containing domain. Djc8 is part of subfamily C that bears only the J-domain. DjC8 is also known as splicing protein spf31, and DNAJC8.

Alternate Names

DnaJ (Hsp40) homolog, subfamily C, member 8, dnaJ homolog subfamily C member 8, HSPC331, SPF31Splicing protein spf31

Gene Symbol

DNAJC8

Additional DNAJC8 Products

Product Documents for DNAJC8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNAJC8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJC8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJC8 Antibody - BSA Free and earn rewards!

Have you used DNAJC8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies