DUSP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56808

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DUSP4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS

Reactivity Notes

Mouse 89%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DUSP4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DUSP4 Antibody [NBP2-56808]

Immunocytochemistry/ Immunofluorescence: DUSP4 Antibody [NBP2-56808]

Immunocytochemistry/Immunofluorescence: DUSP4 Antibody [NBP2-56808] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.

Applications for DUSP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DUSP4

Mitogen-activated protein (MAP) kinases are a large class of proteins involved in signal transduction pathways that are activated by a range of stimuli and mediate a number of physiological and pathological changes in the cell. Dual specificity phosphatases (DSPs) are a subclass of the protein tyrosine phosphatase (PTP) gene superfamily, which are selective for dephosphorylating critical phosphothreonine and phosphotyrosine residues within MAP kinases. DSP gene expression is induced by a host of growth factors and/or cellular stresses, thereby negatively regulating MAP kinase superfamily members including MAPK/ERK, SAPK/JNK and p38. The members of the dual-specificity phosphatase protein family include MKP-1/CL100 (3CH134), VHR, PAC1, MKP-2, hVH-3 (B23), hVH-5, MKP-3, MKP-X, and MKP- 4. Human MKP-2 maps to chromosome 8p12-p11 and encodes a 394 amino acid, 43 kDa protein that specifically inactivates ERK1, ERK2 and JNK.

Alternate Names

dual specificity phosphatase 4, Dual specificity protein phosphatase hVH2, EC 3.1.3.16, EC 3.1.3.48, HVH2serine/threonine specific protein phosphatase, MAP kinase phosphatase 2, Mitogen-activated protein kinase phosphatase 2, MKP-2dual specificity protein phosphatase 4, MKP2VH1 homologous phosphatase 2, TYP, VH2

Gene Symbol

DUSP4

Additional DUSP4 Products

Product Documents for DUSP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DUSP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DUSP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DUSP4 Antibody - BSA Free and earn rewards!

Have you used DUSP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies