eIF4A1 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-04718
![Western Blot: eIF4A1 AntibodyAzide and BSA Free [NBP3-04718]](https://resources.rndsystems.com/images/products/eIF4A1%20Antibody-Western%20Blot-NBP3-04718-img0005.jpg "Western Blot: eIF4A1 AntibodyAzide and BSA Free [NBP3-04718]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1). MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for eIF4A1 Antibody - Azide and BSA Free
Western Blot: eIF4A1 AntibodyAzide and BSA Free [NBP3-04718]
Western Blot: eIF4A1 Antibody [NBP3-04718] - Western blot analysis of extracts of various cell lines, using eIF4A1 antibody (NBP3-04718) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] -
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] -
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] -
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] -
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] -
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] -
Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for eIF4A1 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:1000 - 1:5000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: eIF4A1
Alternate Names
ATP-dependent RNA helicase eIF4A-1, DDX2Aeukaryotic initiation factor 4A-I, EC 3.6.1, EC 3.6.4.13, EIF4A, EIF-4A, eIF-4A-I, eIF4A-I, eukaryotic initiation factor 4AI, eukaryotic translation initiation factor 4A, eukaryotic translation initiation factor 4A, isoform 1, eukaryotic translation initiation factor 4A1
Gene Symbol
EIF4A1
Additional eIF4A1 Products
Product Documents for eIF4A1 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for eIF4A1 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for eIF4A1 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review eIF4A1 Antibody - Azide and BSA Free and earn rewards!
Have you used eIF4A1 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...