EIF4A3 Antibody (6Y3N4)

Name: EIF4A3 Antibody (6Y3N4)
Brand: Novus Biologicals
SKU: NBP3-16727
Price: 389 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16727

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6Y3N4 expressed in HEK293

View all EIF4A3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 34-125 of human EIF4A3 (P38919). VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EIF4A3 Antibody (6Y3N4)

Western Blot: EIF4A3 Antibody (6Y3N4) [NBP3-16727]

Western Blot: EIF4A3 Antibody (6Y3N4) [NBP3-16727] - Western blot analysis of extracts of various cell lines, using EIF4A3 Rabbit mAb (NBP3-16727) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/ Immunofluorescence: EIF4A3 Antibody (6Y3N4) [NBP3-16727]

Immunocytochemistry/Immunofluorescence: EIF4A3 Antibody (6Y3N4) [NBP3-16727] - Immunofluorescence analysis of U-2 OS cells using EIF4A3 Rabbit mAb (NBP3-16727) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for EIF4A3 Antibody (6Y3N4)

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EIF4A3

EIF4A3 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family.

Alternate Names

ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, EIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34

Gene Symbol

EIF4A3

Additional EIF4A3 Products

Product Documents for EIF4A3 Antibody (6Y3N4)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF4A3 Antibody (6Y3N4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF4A3 Antibody (6Y3N4)

There are currently no reviews for this product. Be the first to review EIF4A3 Antibody (6Y3N4) and earn rewards!

Have you used EIF4A3 Antibody (6Y3N4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image