EIF4E2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17839

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EIF4E2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EIF4E2 Antibody - BSA Free

Western Blot: EIF4E2 Antibody [NBP3-17839]

Western Blot: EIF4E2 Antibody [NBP3-17839]

Western Blot: EIF4E2 Antibody [NBP3-17839] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG
Immunocytochemistry/ Immunofluorescence: EIF4E2 Antibody [NBP3-17839]

Immunocytochemistry/ Immunofluorescence: EIF4E2 Antibody [NBP3-17839]

Immunocytochemistry/Immunofluorescence: EIF4E2 Antibody [NBP3-17839] - Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for EIF4E2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF4E2

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures

Alternate Names

4EHP, 4E-LP, eIF4E type 2, eIF-4E type 2, EIF4EL3, eIF4E-like cap-binding protein, eIF4E-like protein 4E-LP, eukaryotic translation initiation factor 4E family member 2, Eukaryotic translation initiation factor 4E homologous protein, eukaryotic translation initiation factor 4E member 2, eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E-like 34E-LP, IF4e, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3

Gene Symbol

EIF4E2

Additional EIF4E2 Products

Product Documents for EIF4E2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF4E2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF4E2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF4E2 Antibody - BSA Free and earn rewards!

Have you used EIF4E2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies