Elk-1 Antibody (10U8X1)

Novus Biologicals | Catalog # NBP3-15631

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10U8X1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 329-428 of human Elk-1 (NP_001107595.1). GGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Elk-1 Antibody (10U8X1)

Western Blot: Elk-1 Antibody (10U8X1) [NBP3-15631]

Western Blot: Elk-1 Antibody (10U8X1) [NBP3-15631]

Western Blot: Elk-1 Antibody (10U8X1) [NBP3-15631] - Western blot analysis of extracts of various cell lines, using Elk-1 antibody (NBP3-15631) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.
Immunoprecipitation: Elk-1 Antibody (10U8X1) [NBP3-15631]

Immunoprecipitation: Elk-1 Antibody (10U8X1) [NBP3-15631]

Immunoprecipitation: Elk-1 Antibody (10U8X1) [NBP3-15631] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Elk-1 antibody (NBP3-15631). Western blot was performed from the immunoprecipitate using Elk-1 antibody (NBP3-15631) at a dilition of 1:1000.

Applications for Elk-1 Antibody (10U8X1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Elk-1

ELK is a member of the family of genes homologous to the v-Ets oncogene isolated from the E26 eythroblastosis virus. Members of this family exhibit varied patterns of tissue expression. They also share a highly conserved C-terminal domain that may be responsible for the DNA binding activity of all members of the Ets gene family.

Alternate Names

Elk1

Gene Symbol

ELK1

Additional Elk-1 Products

Product Documents for Elk-1 Antibody (10U8X1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Elk-1 Antibody (10U8X1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Elk-1 Antibody (10U8X1)

There are currently no reviews for this product. Be the first to review Elk-1 Antibody (10U8X1) and earn rewards!

Have you used Elk-1 Antibody (10U8X1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Adipokines & Insulin Signaling Pathways
Adipokines & Insulin Signaling Pathway Thumbnail