FGF-8 Antibody (2A11) - Azide and BSA Free

Novus Biologicals | Catalog # H00002253-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2A11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK

Specificity

FGF8 (2A11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for FGF-8 Antibody (2A11) - Azide and BSA Free

ELISA: FGF-8 Antibody (2A11) [H00002253-M05]

ELISA: FGF-8 Antibody (2A11) [H00002253-M05]

ELISA: FGF-8 Antibody (2A11) [H00002253-M05] - Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.
Proximity Ligation Assay: FGF-8 Antibody (2A11) [H00002253-M05]

Proximity Ligation Assay: FGF-8 Antibody (2A11) [H00002253-M05]

Proximity Ligation Assay: FGF-8 Antibody (2A11) [H00002253-M05] - Analysis of protein-protein interactions between FGFR2 and FGF8. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction c
Sandwich ELISA: FGF-8 Antibody (2A11) [H00002253-M05] - Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.

Applications for FGF-8 Antibody (2A11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Proximity Ligation Assay

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FGF-8

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants.

Long Name

Fibroblast Growth Factor 8

Alternate Names

AIGF, FGF8, HBGF-8

Entrez Gene IDs

2253 (Human)

Gene Symbol

FGF8

OMIM

600483 (Human)

UniProt

Additional FGF-8 Products

Product Documents for FGF-8 Antibody (2A11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF-8 Antibody (2A11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FGF-8 Antibody (2A11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FGF-8 Antibody (2A11) - Azide and BSA Free and earn rewards!

Have you used FGF-8 Antibody (2A11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies