FMO3 Antibody (6Q10X9)
Novus Biologicals | Catalog # NBP3-15688
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6Q10X9 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human FMO3 (P31513). KPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLP
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for FMO3 Antibody (6Q10X9)
Western Blot: FMO3 Antibody (6Q10X9) [NBP3-15688]
Western Blot: FMO3 Antibody (6Q10X9) [NBP3-15688] - Western blot analysis of extracts of various cell lines, using FMO3 antibody (NBP3-15688) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Western Blot: FMO3 Antibody (6Q10X9) [NBP3-15688]
Western Blot: FMO3 Antibody (6Q10X9) [NBP3-15688] - Western blot analysis of extracts of various cell lines, using FMO3 antibody (NBP3-15688) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.Immunocytochemistry/ Immunofluorescence: FMO3 Antibody (6Q10X9) [NBP3-15688] -
Immunocytochemistry/ Immunofluorescence: FMO3 Antibody (6Q10X9) [NBP3-15688] - Confocal imaging of paraffin-embedded Human liver tissue using FMO3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunocytochemistry/ Immunofluorescence: FMO3 Antibody (6Q10X9) [NBP3-15688] -
Immunocytochemistry/ Immunofluorescence: FMO3 Antibody (6Q10X9) [NBP3-15688] - Confocal imaging of paraffin-embedded Mouse liver tissue using FMO3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunocytochemistry/ Immunofluorescence: FMO3 Antibody (6Q10X9) [NBP3-15688] -
Immunocytochemistry/ Immunofluorescence: FMO3 Antibody (6Q10X9) [NBP3-15688] - Confocal imaging of paraffin-embedded Rat liver tissue using FMO3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for FMO3 Antibody (6Q10X9)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: FMO3
Alternate Names
dimethylaniline monooxygenase [N-oxide-forming] 3, Dimethylaniline oxidase 3, dJ127D3.1, EC 1.14.13.8, flavin containing monooxygenase 3, FMO 3, FMO form 2, FMO II, FMOII, Hepatic flavin-containing monooxygenase 3, hepatic flavin-containing monooxygenase-3, MGC34400, TMAU
Gene Symbol
FMO3
Additional FMO3 Products
Product Documents for FMO3 Antibody (6Q10X9)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FMO3 Antibody (6Q10X9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for FMO3 Antibody (6Q10X9)
There are currently no reviews for this product. Be the first to review FMO3 Antibody (6Q10X9) and earn rewards!
Have you used FMO3 Antibody (6Q10X9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...