HOXA13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17383

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXA13 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HOXA13 Antibody [NBP3-17383]

Immunocytochemistry/ Immunofluorescence: HOXA13 Antibody [NBP3-17383]

Immunocytochemistry/Immunofluorescence: HOXA13 Antibody [NBP3-17383] - Staining of human cell line RT4 shows localization to nucleoplasm & mitotic chromosome.
HOXA13 Antibody

Immunohistochemistry-Paraffin: HOXA13 Antibody [NBP3-17383] -

Immunohistochemistry-Paraffin: HOXA13 Antibody [NBP3-17383] - Staining of mouse embryonic limb using HOXA13 antibody. Image from verified customer review.
HOXA13 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HOXA13 Antibody - BSA Free [NBP3-17383]

Chromatin Immunoprecipitation-exo-Seq: HOXA13 Antibody - BSA Free [NBP3-17383]

ChIP-Exo-Seq composite graph for Anti-HOXA13 (NBP3-17383) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HOXA13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

HOXA13 Antibody validated for Immunohistochemistry-Paraffin from a verified customer review.
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Reviewed Applications

Read 1 review rated 5 using NBP3-17383 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXA13

HOXA13 is 388 amino acids long, weighing approximately 40 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. Current studies are being done on several diseases and disorders including triphalangeal thumbs brachyectrodactyly, guttmacher syndrome, short stature, hypospadias, esophageal squamous cell carcinoma, labryinthitis, leukemia, ulcerative colitis, Hirschsprung's disease, microphthalmia, and vaginitis.HOXA13 has also been shown to have interactions with MEIS1, SMAD2, MEIS2, MEIS3, and SMAD1.

Alternate Names

homeo box 1J, homeo box A13, homeobox A13, Homeobox protein Hox-1J, homeobox protein HOXA13, HOX1, HOX1Jhomeobox protein Hox-A13, transcription factor HOXA13

Gene Symbol

HOXA13

Additional HOXA13 Products

Product Documents for HOXA13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXA13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXA13 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used HOXA13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • HOXA13 Antibody
    Name: Xiaowen Chen
    Application: Immunohistochemistry-Paraffin
    Sample Tested: 1 - Embryonic Lung; 2 - Embryonic limb
    Species: Mouse
    Verified Customer | Posted 04/18/2023
    shows a nice nucleus staining in mouse embryonic limb cells.
    HOXA13 Antibody - BSA Free NBP3-17383
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...