HOXC9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58032

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HOXC9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXC9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HOXC9 Antibody [NBP2-58032]

Immunocytochemistry/ Immunofluorescence: HOXC9 Antibody [NBP2-58032]

Immunocytochemistry/Immunofluorescence: HOXC9 Antibody [NBP2-58032] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
HOXC9 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HOXC9 Antibody - BSA Free [NBP2-58032]

Chromatin Immunoprecipitation-exo-Seq: HOXC9 Antibody - BSA Free [NBP2-58032]

ChIP-Exo-Seq composite graph for Anti-HOXC9 (NBP2-58032) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HOXC9 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXC9

The HOXC9 gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcriptionfactors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similarhomeobox gene clusters,

Alternate Names

homeobox C9, Homeobox protein Hox-3B, homeobox protein Hox-C9, HOX3, HOX3Bhomeo box C9

Gene Symbol

HOXC9

Additional HOXC9 Products

Product Documents for HOXC9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOXC9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXC9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXC9 Antibody - BSA Free and earn rewards!

Have you used HOXC9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies