IKZF5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58346

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IKZF5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IKZF5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: IKZF5 Antibody [NBP2-58346]

Immunocytochemistry/ Immunofluorescence: IKZF5 Antibody [NBP2-58346]

Immunocytochemistry/Immunofluorescence: IKZF5 Antibody [NBP2-58346] - Staining of human cell line A-431 shows localization to nucleoplasm.
IKZF5 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: IKZF5 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: IKZF5 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-IKZF5 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for IKZF5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IKZF5

Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Pegasus, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM]

Alternate Names

DKFZp781B0249, FLJ22973, IKAROS family zinc finger 5 (Pegasus), Ikaros family zinc finger protein 5, Pegasus, zinc finger protein Pegasus, zinc finger protein, subfamily 1A, 5, zinc finger protein, subfamily 1A, 5 (Pegasus), zinc finger transcription factor Pegasus, ZNFN1A5

Gene Symbol

IKZF5

Additional IKZF5 Products

Product Documents for IKZF5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IKZF5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IKZF5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IKZF5 Antibody - BSA Free and earn rewards!

Have you used IKZF5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies