INSM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55336

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation Sequencing

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all INSM2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLPQGPYTEGVLGRRVPVPGSTSGGRGSEIFVCP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for INSM2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: INSM2 Antibody [NBP2-55336]

Immunocytochemistry/ Immunofluorescence: INSM2 Antibody [NBP2-55336]

Immunocytochemistry/Immunofluorescence: INSM2 Antibody [NBP2-55336] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
INSM2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: INSM2 Antibody - BSA Free [NBP2-55336]

Chromatin Immunoprecipitation-exo-Seq: INSM2 Antibody - BSA Free [NBP2-55336]

ChIP-Exo-Seq composite graph for Anti-INSM2 (NBP2-55336) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for INSM2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation Sequencing

1-10µg per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: INSM2

INSM2 may function as a growth suppressor or tumor suppressor in liver cells and in certain neurons

Alternate Names

insulinoma-associated 2, Nbla106, zinc finger protein IA-6

Gene Symbol

INSM2

Additional INSM2 Products

Product Documents for INSM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for INSM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INSM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review INSM2 Antibody - BSA Free and earn rewards!

Have you used INSM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies