Q: I'm looking for a good antibody for integrins that works in rats. I would need it for Western Blot, Immunocyto- as well as Immunohistochemistry. I'm especially interested in beta1.

A: I would recommend NB110-57123 as it has been validated using rat samples in WB, IHC-P, and FACS. Although we do not list ICC on the datasheet for this antibody I believe it will work in ICC because it works in Flow Cytometry and has been validated to stain tissue. We have several other Integrin targets. To search for what you are looking for I recommend typing Integrin into the search area at the top of our website, then review the list of suggested targets that poplulate below the search. Once you click on a particular Integrin you can narrow the results with our filter. I recommend filtering to primary antibodies, by target name, species of interest you can filter to rat. If you so choose you can also filter further by application, host, clonality, etc.

Integrin beta 1/CD29 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-62660PEP

Submit a review

Product Documents

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

E. coli

Applications

Antibody Competition

View all Integrin beta 1/CD29 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGB1.

Source: E. coli

Amino Acid Sequence: FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62660.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-62660PEP

Formulation	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin beta 1/CD29

Integrin beta-1 (ITGB1, CD29, VLA-beta) is the beta subunit found in the integrin families, forming a heterodimer integrin receptor through non-covalent bonding with various integrin alpha subunits. Integrin heterodimer containing Integrin beta-1 binds to various cell surface and extracellular proteins (CD49a-f, CD51) to mediate cell to cell and cell to matrix adhesion (1). Integrin beta-1 plays a critical role in the cell adhesion and recognition in embryogenesis, hemostasis, immune response, tissue repair, metastatic diffusion of tumor cells and development (2, 3, 4).

Alternate Names

CD29, ITGB1

Gene Symbol

ITGB1

Additional Integrin beta 1/CD29 Products

Product Documents for Integrin beta 1/CD29 Recombinant Protein Antigen

Download Product Datasheets

Download Antigen Blocking Protocol

Download SDS

Product Specific Notices for Integrin beta 1/CD29 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Adhesion Molecules

Adhesion Molecules on Endothelial Cells

Adipose-derived Stem Cell Markers

Cancer Biomarkers

Cardiac Stem Cell Markers

Epithelial Cell Polarity

Integrins and Associated Molecules

Mesenchymal Stem Cell Markers

Skin Stem Cell Markers

Customer Reviews for Integrin beta 1/CD29 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Integrin beta 1/CD29 Recombinant Protein Antigen and earn rewards!

Have you used Integrin beta 1/CD29 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review

FAQs for Integrin beta 1/CD29 Recombinant Protein Antigen

Showing 1 - 1 的 1 FAQ Showing All

Q: I'm looking for a good antibody for integrins that works in rats. I would need it for Western Blot, Immunocyto- as well as Immunohistochemistry. I'm especially interested in beta1.

A: I would recommend NB110-57123 as it has been validated using rat samples in WB, IHC-P, and FACS. Although we do not list ICC on the datasheet for this antibody I believe it will work in ICC because it works in Flow Cytometry and has been validated to stain tissue. We have several other Integrin targets. To search for what you are looking for I recommend typing Integrin into the search area at the top of our website, then review the list of suggested targets that poplulate below the search. Once you click on a particular Integrin you can narrow the results with our filter. I recommend filtering to primary antibodies, by target name, species of interest you can filter to rat. If you so choose you can also filter further by application, host, clonality, etc.