KIN Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58750

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KIN Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTLGPSALKTIGSSASVKRKESS

Reactivity Notes

Mouse 82%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KIN Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KIN Antibody [NBP2-58750]

Immunocytochemistry/ Immunofluorescence: KIN Antibody [NBP2-58750]

Immunocytochemistry/Immunofluorescence: KIN Antibody [NBP2-58750] - Staining of human cell line Hep G2 shows localization to nucleus.
KIN Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: KIN Antibody - BSA Free [NBP2-58750]

Chromatin Immunoprecipitation-exo-Seq: KIN Antibody - BSA Free [NBP2-58750]

ChIP-Exo-Seq composite graph for Anti-KIN (NBP2-58750) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for KIN Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIN

The protein encoded by the KIN gene is a nuclear protein that forms intranuclear foci during proliferation and isredistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization ofthe protein, suggesting its participation in the cellular response to DNA damage. Originally selected based onprotein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of thebacterial RecA protein, a characteristic shared by this human ortholog. (provided by RefSeq)

Alternate Names

antigenic determinant of recA protein (mouse) homolog, Binding to curved DNA, BTCDDNA/RNA-binding protein KIN17, KIN, antigenic determinant of recA protein homolog, KIN, antigenic determinant of recA protein homolog (mouse), KIN17antigenic determinant of recA protein homolog

Gene Symbol

KIN

Additional KIN Products

Product Documents for KIN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KIN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIN Antibody - BSA Free and earn rewards!

Have you used KIN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies