L3MBTL4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56598

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all L3MBTL4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YWCDVNSPYVQPVGWCQENGRTLIAPQGYPNPENFSWTEYLEATQTNAVPAKVFKMRLPHGFL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for L3MBTL4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: L3MBTL4 Antibody [NBP2-56598]

Immunocytochemistry/ Immunofluorescence: L3MBTL4 Antibody [NBP2-56598]

Immunocytochemistry/Immunofluorescence: L3MBTL4 Antibody [NBP2-56598] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & vesicles.

Applications for L3MBTL4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: L3MBTL4

L3MBTL4, also known as Lethal(3)malignant brain tumor-like protein 4, has a 623 amino acid isoform that is 71 kDa and a short 534 amino acid that is 61 kDa, nucleus located; belongs to Putative Polycomb group (PcG), and maintains the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. There has been research revolving around the L3MBTL4 protein involvement in breast cancer. This protein is involved in transcription, DNA-dependent; regulation of transcription, DNA-dependent; and chromatin modification pathways.

Alternate Names

FLJ35936, H-l(3)mbt-like protein 4, HsT1031, l(3)mbt-like 4 (Drosophila), L(3)mbt-like protein 4, lethal(3)malignant brain tumor-like protein 4

Gene Symbol

L3MBTL4

Additional L3MBTL4 Products

Product Documents for L3MBTL4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for L3MBTL4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for L3MBTL4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review L3MBTL4 Antibody - BSA Free and earn rewards!

Have you used L3MBTL4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies