LSD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58483

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LSD1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LSD1 Antibody [NBP2-58483]

Immunocytochemistry/ Immunofluorescence: LSD1 Antibody [NBP2-58483]

Immunocytochemistry/Immunofluorescence: LSD1 Antibody [NBP2-58483] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
LSD1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: LSD1 Antibody - BSA Free [NBP2-58483]

Chromatin Immunoprecipitation-exo-Seq: LSD1 Antibody - BSA Free [NBP2-58483]

ChIP-Exo-Seq composite graph for Anti-KDM1A (NBP2-58483) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for LSD1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lysine (K)-specific Demethylase 1A/KDM1A/LSD1

LSD1 a recently identified, first known lysine-specific histone demethylase, is an 886 amino acid nuclear protein belonging to flavin monoamine oxidase family. It contains a SWIRM domain, a FAD-binding motif and an amine oxidase domain. This protein is ubiquitously expressed and is a component of several histone deacetylase complexes. LSD1 acts as a component of the CoREST and other transcriptional co-repressor complexes and also plays an important role in silencing neuronal-specific genes in non-neuronal cells. It is also known to demethylate Lys-4 of histone H3, a specific tag for epigenetic transcriptional activation. Reports suggest that it plays an important role in stimulating androgen-receptor-dependent transcription converting oxygen to hydrogen peroxide (might use alternative electron acceptors). Along with nuclear FHL2 it serves as a novel biomarker predictive for prostate cancer.

Alternate Names

AOF2, BHC110, LSD1, Lysine (K)specific Demethylase 1A

Gene Symbol

KDM1A

Additional Lysine (K)-specific Demethylase 1A/KDM1A/LSD1 Products

Product Documents for LSD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LSD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for LSD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LSD1 Antibody - BSA Free and earn rewards!

Have you used LSD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail