MMP-9 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-85575PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP9.

Source: E. coli

Amino Acid Sequence: PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85575.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-85575PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MMP-9

Matrix metalloproteinases (MMPs) are zinc-dependent endopeptidases that degrade substances within the extracellular matrix. The MMP family includes six different groups of enzymes: collagenases, gelatinases, stromelysins, transmembrane MMPs, matrilysins and others. MMPs are secreted as proenzymes that have to be cleaved in order to be activated. Other MMPs, plasmins as well as other factors activate MMPs. MMPs are thought to play an important role in tissue remodeling associated with various physiological and pathological processes. MMP9 degrades of proteins in the extracellular matrix and activates growth factors like proTGF beta and proTNF alpha. MMP9 contributes to the invasion and metastasis of various human malignancies.

Long Name

Matrix Metalloproteinase 9

Alternate Names

CLG4B, Gelatinase B, GELB, MANDP2, MMP9

Gene Symbol

MMP9

Additional MMP-9 Products

Product Documents for MMP-9 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP-9 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for MMP-9 Recombinant Protein Antigen

Customer Reviews for MMP-9 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review MMP-9 Recombinant Protein Antigen and earn rewards!

Have you used MMP-9 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for MMP-9 Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q:  I’m looking for a pair of antibodies to MMP-9 that can be used in a sandwich assay. Do you carry any? 

    A:

    We have 10 primary antibodies for MMP-9 that have been tested in ELISA, seen here.
    It looks like 2 have been tested for capture (please note the tested species for each of these), seen here.
    6 have been tested for detection, seen here.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes