MRPL34 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93040

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all MRPL34 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 16-92 of human MRPL34 (NP_076426.1). AALLGGRWLQPRAWLGFPDAWGLPTPQQARGKARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MRPL34 Antibody - Azide and BSA Free

Western Blot: MRPL34 AntibodyAzide and BSA Free [NBP2-93040]

Western Blot: MRPL34 AntibodyAzide and BSA Free [NBP2-93040]

Western Blot: MRPL34 Antibody [NBP2-93040] - Analysis of extracts of various cell lines, using MRPL34 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
MRPL34 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MRPL34 Antibody - Azide and BSA Free [NBP2-93040] -

Immunocytochemistry/ Immunofluorescence: MRPL34 Antibody - Azide and BSA Free [NBP2-93040] - Immunofluorescence analysis of L929 cells using MRPL34 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for MRPL34 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MRPL34

MRPL34, also known as 39 S ribosomal protein L34, mitochondrial, is a 10.2 kDa, 92 amino acid protein that is involved in mitochondrial protein synthesis as a member of the ribosomal protein L34P family. Currently, there is no research linking this protein to any diseases. The protein interacts with MRPL2, MRPL24, MRPL11, MRPL13, and MRPL22.

Alternate Names

L34mtMGC24974, MGC2633, mitochondrial ribosomal protein L34, MRP-L34,39S ribosomal protein L34, mitochondrial

Gene Symbol

MRPL34

Additional MRPL34 Products

Product Documents for MRPL34 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRPL34 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MRPL34 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MRPL34 Antibody - Azide and BSA Free and earn rewards!

Have you used MRPL34 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies