Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MTHFD1L Antibody - BSA Free
Western Blot: MTHFD1L Antibody [NBP2-57852]
Western Blot: MTHFD1L Antibody [NBP2-57852] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.Immunocytochemistry/ Immunofluorescence: MTHFD1L Antibody [NBP2-57852]
Immunocytochemistry/Immunofluorescence: MTHFD1L Antibody [NBP2-57852] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.Simple Western: MTHFD1L Antibody [NBP2-57852]
Simple Western: MTHFD1L Antibody [NBP2-57852] - Human U251 glioma cell line; whole cell lysate. Antibody at 1:250, 0.08 ug/uL total protein. Simple Western image submitted by a verified customer review.Applications for MTHFD1L Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25 - 2 ug/mL
Simple Western
1:250
Western Blot
0.04 - 0.4 ug/mL
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This MTHFD1L Antibody is validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: Tested in Human U251 glioma cell line, whole cell lysate, separated by Size, antibody dilution of 1:250
See Simple Western Antibody Database for Simple Western validation: Tested in Human U251 glioma cell line, whole cell lysate, separated by Size, antibody dilution of 1:250
Reviewed Applications
Read 1 review rated 4 using NBP2-57852 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MTHFD1L
Alternate Names
10-formyl-THF synthetase, dJ292B18.2, DKFZp586G1517, EC 6.3.4.3, FLJ21145, Formyltetrahydrofolate synthetase, formyltetrahydrofolate synthetase domain containing 1, FTHFSDC1, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, mitochondrial C1-tetrahydrofolate synthase, mitochondrial C1-tetrahydrofolate synthetase, monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS
Gene Symbol
MTHFD1L
Additional MTHFD1L Products
Product Documents for MTHFD1L Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MTHFD1L Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MTHFD1L Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used MTHFD1L Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Simple WesternSample Tested: U251 glioma cell line; whole cell lysateSpecies: HumanVerified Customer | Posted 02/03/2020matériel: 1x25capillaires 12-230kDa Anticorps 1/250 Protéine : 0.08µg/µLBio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...