Nardilysin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58484

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nardilysin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT

Reactivity Notes

Mouse 82%, Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nardilysin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Nardilysin Antibody [NBP2-58484]

Immunocytochemistry/ Immunofluorescence: Nardilysin Antibody [NBP2-58484]

Immunocytochemistry/Immunofluorescence: Nardilysin Antibody [NBP2-58484] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for Nardilysin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nardilysin

NRD1, also known as Nardilysin, has 2 isoforms, a 1,150 amino acid isoform1 that is 132 kDa and a 1,218 amino acid isoform2 that is 139 kDa, primarily found in adult heart, skeletal muscle, and testis, it is a member of the peptidase M16 family, and slices peptide substrates at the N-terminus of arginine residues in dibasic moieties. Disease research is being performed in relation to NRD1 and differentiating neuroblastoma, Down syndrome, Alzheimer's disease, neuroblastoma, prostatitis, neuronitis, and alcoholism. Interactions with NRD1 protein have been shown to involve TP53, HBEGF, CALCA, MYC, FBXW11, and more than 50 other proteins in proteolysis, neuromuscular junction development, cell proliferation, cell migration, and positive regulation of membrane protein ectodomain proteolysis processes.

Alternate Names

EC 3.4.24, EC 3.4.24.61, hNRD1, hNRD2, nardilysin, nardilysin (N-arginine dibasic convertase), N-arginine dibasic convertase, NRD convertase, NRD-C

Gene Symbol

NRDC

Additional Nardilysin Products

Product Documents for Nardilysin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nardilysin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nardilysin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nardilysin Antibody - BSA Free and earn rewards!

Have you used Nardilysin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies