NCAPD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55493

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NCAPD3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NCAPD3 Antibody [NBP2-55493]

Immunocytochemistry/ Immunofluorescence: NCAPD3 Antibody [NBP2-55493]

Immunocytochemistry/Immunofluorescence: NCAPD3 Antibody [NBP2-55493] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

Applications for NCAPD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCAPD3

Smad3 is a 50 kDa member of a family of proteins that act as key mediators of TGF beta superfamily signaling in cell proliferation, differentiation and development. The Smad family is divided into three subclasses: receptor regulated Smads, activin/TGF beta receptor regulated (Smad2 and 3) or BMP receptor regulated (Smad 1, 5, and 8); the common partner, (Smad4) that functions via its interaction to the various Smads; and the inhibitory Smads, (Smad6 and 7). Activated Smad3 oligomerizes with Smad4 upon TGF beta stimulation and translocates as a complex into the nucleus, allowing its binding to DNA and transcription factors. Phosphorylation of the two TGF beta dependent serines 423 and 425 in the C terminus of Smad3 is critical for Smad3 transcriptional activity and TGF beta signaling.

Alternate Names

CAPD3, CAP-D3, FLJ42888, hCAP-D3condensin-2 complex subunit D3, hcp-6, hHCP-6, KIAA0056MGC104671, Non-SMC condensin II complex subunit D3, non-SMC condensin II complex, subunit D3

Gene Symbol

NCAPD3

Additional NCAPD3 Products

Product Documents for NCAPD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NCAPD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NCAPD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCAPD3 Antibody - BSA Free and earn rewards!

Have you used NCAPD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...