Neurabin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-69010

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Neurabin 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Neurabin 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Neurabin 1 Antibody [NBP2-69010]

Immunocytochemistry/ Immunofluorescence: Neurabin 1 Antibody [NBP2-69010]

Immunocytochemistry/Immunofluorescence: Neurabin 1 Antibody [NBP2-69010] - Staining of human cell line A549 shows localization to plasma membrane.

Applications for Neurabin 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neurabin 1

Neurabin 1 is a brain-specific protein which contains an F-actin binding domain, a PDZ domain, a transmembrane-protein-interacting-domain, and a coiled-coil region. As its structure suggests, Neurabin 1 is a promiscuous protein binding to F-actin, protein phosphatase 1, TGN38, and p70 S6 kinase. Found exclusively in brain, this protein is highly concentrated in the synapse and has also been shown to be enriched in the lamellipodia of the growth cone during neuronal development. Neurabin 1 appears to be a bridging protein by targeting other proteins to the synapse or by linking membrane proteins to the actin cytoskeleton.

Alternate Names

KIAA1222NRBI, neurabin-1, Neurabin-IFLJ20068, Neural tissue-specific F-actin-binding protein I, NRB1, Protein phosphatase 1 regulatory subunit 9A, protein phosphatase 1, regulatory (inhibitor) subunit 9A

Gene Symbol

PPP1R9A

Additional Neurabin 1 Products

Product Documents for Neurabin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Neurabin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neurabin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neurabin 1 Antibody - BSA Free and earn rewards!

Have you used Neurabin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies