NFKBID Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17608

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NFKBID Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NFKBID Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NFKBID Antibody [NBP3-17608]

Immunocytochemistry/ Immunofluorescence: NFKBID Antibody [NBP3-17608]

Immunocytochemistry/Immunofluorescence: NFKBID Antibody [NBP3-17608] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol.
NFKBID Antibody - BSA Free Chromatin Immunoprecipitation ChIP: NFKBID Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: NFKBID Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-NFKBID tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for NFKBID Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFKBID

NFKBID may regulate the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity.Functions in the regulation of inflammatory responses. May also regulate TCR-induced negative selection of thymocytes

Alternate Names

delta, IkappaBdelta, I-kappa-B-delta, IkappaBNSikappaBdelta, ikB-delta, IKBNS, MGC11314, MGC149503, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, TA-NFKBHNF-kappa-B inhibitor delta, T-cell activation NFKB-like protein

Gene Symbol

NFKBID

Additional NFKBID Products

Product Documents for NFKBID Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NFKBID Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFKBID Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFKBID Antibody - BSA Free and earn rewards!

Have you used NFKBID Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies