Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

Novus Biologicals | Catalog # H00001139-Q01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE
View all Nicotinic Acetylcholine R alpha 7/CHRNA7 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 182-502 of Human CHRNA7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

61.05 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

SDS-PAGE: Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein [H00001139-Q01]

SDS-PAGE: Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein [H00001139-Q01]

SDS-Page: Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein [H00001139-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue

Formulation, Preparation, and Storage

H00001139-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 7/CHRNA7

CHRNA7( AAH37571, 1 a.a. - 322 a.a.) recombinant protein with GST.

Long Name

Nicotinic Acetylcholine Receptor alpha 7

Alternate Names

CHRNA7, CHRNA7-2, Nicotinic Acetylcholine Ra 7

Gene Symbol

CHRNA7

Additional Nicotinic Acetylcholine R alpha 7/CHRNA7 Products

Product Documents for Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein and earn rewards!

Have you used Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

Showing  1 - 2 的 2 FAQs Showing All

  • Q: I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?

    A:

    We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.

  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

  • Q: I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?

    A:

    We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.

  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 2 的 2 FAQs Showing All
View all FAQs for Proteins and Enzymes