NTS1/NTSR1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-95192

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all NTS1/NTSR1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NTS1/NTSR1 (NP_002522.2). MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NTS1/NTSR1 Antibody - Azide and BSA Free

Western Blot: NTS1/NTSR1 AntibodyAzide and BSA Free [NBP2-95192]

Western Blot: NTS1/NTSR1 AntibodyAzide and BSA Free [NBP2-95192]

Western Blot: NTS1/NTSR1 Antibody [NBP2-95192] - Analysis of extracts of DU145 cells, using NTSR1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.

Applications for NTS1/NTSR1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NTS1/NTSR1

Neurotensin receptor-1 (NTSR1) is a G protein-coupled receptor (GPCR) that has been identified as a mediator of cancer progression. It mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secretion. Defects in NTSR are associated with variance in working memory performance among healthy adults.

Long Name

Neurotensin Receptor 1

Alternate Names

NTR1, NTRH, NTRR, NTSR1

Gene Symbol

NTSR1

Additional NTS1/NTSR1 Products

Product Documents for NTS1/NTSR1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NTS1/NTSR1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NTS1/NTSR1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NTS1/NTSR1 Antibody - Azide and BSA Free and earn rewards!

Have you used NTS1/NTSR1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies