NUSAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13685

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NUSAP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHEKQESQDFRATAKVPSPPDEHQEAENAVSSGNRDSKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUSAP1 Antibody - BSA Free

Western Blot: NUSAP1 Antibody [NBP2-13685]

Western Blot: NUSAP1 Antibody [NBP2-13685]

Western Blot: NUSAP1 Antibody [NBP2-13685] - Human cancer cell lines. NuSAP1 protein expression 72 hours after siRNA transfection. WB image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: NUSAP1 Antibody [NBP2-13685]

Immunocytochemistry/ Immunofluorescence: NUSAP1 Antibody [NBP2-13685]

Immunocytochemistry/Immunofluorescence: NUSAP1 Antibody [NBP2-13685] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.
NUSAP1 Antibody - BSA Free

Western Blot: NUSAP1 Antibody - BSA Free [NBP2-13685] -

ILF2 depletion promotes R-loop accumulation and DNA damage which are prevented by NUSAP1 depletion. (A) Dot-blot analysis of R-loop levels in LNCaP cells without and with 10 μM Camptothecin (CPT) treatment for 60 min after 48 h post-transfection of siNUSAP1, siILF2 or both. siNUSAP1 alone reduced R-loop levels and siILF2 significantly increased R-loops. siNUSAP1 and siILF2 together completely corrected R-loop levels compared to siILF2 alone. Bottom panels anti-DS DNA antibody serves as loading control. (B) S9.6 signal from the dot-blots in the 100 ng nucleic acid samples normalized by dsDNA signal quantified using Image J (n = 3). (C) Immunofluorescent staining using anti-gamma H2AX (red) to assess DNA damage without and with CPT treatment in LNCaP cells. siNUSAP1 decreases gamma H2AX staining while siILF2 increases staining significantly. siNUSAP1 reduces gamma H2AX levels to baseline in the presence of siILF2. DAPI (blue). Scale bar = 10 um (D) gamma H2AX fluorescence intensities quantified by Image J (n = 3). (E) Representative Western blot analysis of NUSAP1, ILF2, DHX9, H2AX, and gamma H2AX protein levels (n = 3). siCtrl, siControl; siN + siI, siNUSAP1 + siILF2. *, p < 0.05; **, p < 0.01; ****, p < 0.0001; NS, p > 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37047232), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NUSAP1 Antibody - BSA Free

Western Blot: NUSAP1 Antibody - BSA Free [NBP2-13685] -

NUSAP1 depletion reduces CPT-induced R-loop accumulation and DNA damage and DHX9 depletion increases both. (A) Dot-blot analysis of R-loop levels in LNCaP cells without and with 10 μM Camptothecin (CPT) treatment for 60 min after 48 h post-transfection of siNUSAP1, siDHX9, or both. Serial dilutions of RNA/DNA hybrids (R-loops) and dsDNA extracts were spotted on the membrane for each condition. R-loop formation was increased with CPT treatment. siNUSAP1 alone reduced R-loop levels, while siDHX9 significantly increased R-loops. siDHX9 and siNUSAP1 together did not reduce the accumulation of R-loops compared to siDHX9 alone. Bottom panels anti-DS DNA antibody serves as loading control. (B) S9.6 signal from the dot-blots in the 100 ng nucleic acid samples normalized by dsDNA signal quantified using Image J (n = 3). (C) Immunofluorescent staining using anti-gamma H2AX (red) to assess DNA damage without and with CPT treatment in LNCaP cells. siNUSAP1 decreases gamma H2AX staining while siDHX9 increases staining significantly, which is not affected by siNUSAP1. DAPI (blue). Scale bar = 10 um. (D) gamma H2AX fluorescence intensities quantified by Image J (n = 3). (E) Representative Western blot analysis of NUSAP1, ILF2, DHX9, H2AX, and gamma H2AX protein levels with CPT and the respective siRNA treatments (n = 3). siCtrl, siControl; siN + siD, siNUSAP1 + siDHX9. *, p < 0.05; **, p < 0.01; ****, p < 0.0001; NS, p > 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37047232), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NUSAP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100. This NUSAP1 Antibody is validated for Western blot from a verified customer review.

Reviewed Applications

Read 1 review rated 5 using NBP2-13685 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUSAP1

NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 (PubMed 12963707)).(supplied by OMIM)

Alternate Names

ANKTNUSAP, BM037, FLJ13421, LNP, nucleolar and spindle associated protein 1, nucleolar and spindle-associated protein 1, nucleolar protein ANKT, NuSAP, NuSAP1, PRO0310p1, Q0310, SAPL

Gene Symbol

NUSAP1

Additional NUSAP1 Products

Product Documents for NUSAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NUSAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUSAP1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used NUSAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • NUSAP1 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human cancer cell lines
    Species: Human
    Verified Customer | Posted 05/26/2021
    NuSAP1 protein expression 72 hours after siRNA transfection.
    NUSAP1 Antibody - BSA Free NBP2-13685

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies