OBFC2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58145

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OBFC2B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OBFC2B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OBFC2B Antibody [NBP2-58145]

Immunocytochemistry/ Immunofluorescence: OBFC2B Antibody [NBP2-58145]

Immunocytochemistry/Immunofluorescence: OBFC2B Antibody [NBP2-58145] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
OBFC2B Antibody - BSA Free Chromatin Immunoprecipitation ChIP: OBFC2B Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: OBFC2B Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-OBFC2B tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for OBFC2B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OBFC2B

Single-stranded DNA -binding protein (SSB1) is phosphorylated by ATM in response to DNA damage. SSB1 is required for checkpoint activation and is critical for genomic stability.

Alternate Names

LP3587, MGC2731, oligonucleotide/oligosaccharide-binding fold containing 2B, Oligonucleotide/oligosaccharide-binding fold-containing protein 2B, Sensor of single-strand DNA complex subunit B1, Sensor of ssDNA subunit B1, Single-stranded DNA-binding protein 1, SOSS complex subunit B1, SOSS-B1, SSB1hSSB1

Gene Symbol

NABP2

Additional OBFC2B Products

Product Documents for OBFC2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OBFC2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OBFC2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OBFC2B Antibody - BSA Free and earn rewards!

Have you used OBFC2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies