OSCAR Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21366

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OSCAR Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit OSCAR Antibody - BSA Free (NBP3-21366) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for OSCAR Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: OSCAR Antibody [NBP3-21366] -

Immunocytochemistry/Immunofluorescence: OSCAR Antibody [NBP3-21366] -

Staining of human cell line EFO-21 shows localization to nucleoplasm, plasma membrane & cytosol.

Applications for OSCAR Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OSCAR

Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Long Name

Osteoclast-associated Receptor

Alternate Names

hOSCAR, MGC33613, osteoclast associated receptor OSCAR-S1, osteoclast associated receptor OSCAR-S2, osteoclast associated, immunoglobulin-like receptor, osteoclast-associated immunoglobulin-like receptor, Osteoclast-associated receptor, PIGR3, PIgR-3, Poly-Ig receptor 3, Polymeric immunoglobulin receptor 3

Gene Symbol

OSCAR

Additional OSCAR Products

Product Documents for OSCAR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OSCAR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Osteoblast and Osteoclast Markers

Customer Reviews for OSCAR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OSCAR Antibody - BSA Free and earn rewards!

Have you used OSCAR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies