Pax6 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-89100PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAX6.

Source: E. coli

Amino Acid Sequence: VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89100.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-89100PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Pax6

PAX genes encode nuclear transcription factors which are regarded as major controllers of developmental processes in both vertebrates and invertebrates. Mutations in murine PAX genes underlie three natural mouse alleles and several corresponding human syndromes (aniridia, foveal hypoplasia and Peters® anomaly). Murine PAX genes have been shown to be proto-oncogenes. Furthermore, human PAX genes have recently been demonstrated to play an influential part in some common human cancers such as brain tumors and lymphomas. All PAX genes encode a DNA-binding domain termed the paired domain and in addition some also encode a second binding domain--the paired type homeobox. PAX6 is involved in the early development of the optical vesicle and has been shown to interact with Six3, another important visual development protein.

Long Name

Paired Box Gene 6

Alternate Names

keratitis), MGC17209, Oculorhombin, paired box 6, paired box protein Pax-6

Gene Symbol

PAX6

Additional Pax6 Products

Product Documents for Pax6 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pax6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Pax6 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Pax6 Recombinant Protein Antigen and earn rewards!

Have you used Pax6 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Pax6 Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: What PAX6 antibody is recommend to use in ICC staining of human stem cells differentiated neural precursors?

    A:

    By performing a search on PAX6 then refining this to antibodies which have been validated with human samples and for ICC, I can see that we have three products to meet your requirements. You can see all three of these antibodies. These products are listed based on sales and citations, however all of our antibodies are covered by our 100% guarantee to work in the species and applications listed on our website and on our product datasheets. You can read more about our quality guarantee here.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes