PCPTP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58834

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK

Reactivity Notes

Mouse 80%, Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PCPTP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PCPTP1 Antibody [NBP2-58834]

Immunocytochemistry/ Immunofluorescence: PCPTP1 Antibody [NBP2-58834]

Immunocytochemistry/Immunofluorescence: PCPTP1 Antibody [NBP2-58834] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Applications for PCPTP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCPTP1

PCPTP1, also known as Receptor-type tyrosine-protein phosphatase R, has 4 isoforms, a 657 amino acid isoform that is 74 kDa, a 412 amino acid isoform t5hat is 47 k Da, a 451 amino acid isoform that is 51 kDa, and a 545 amino acid isoform that is 61 kDa, expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate, sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. The protein is being studied for its involvement in colorectal cancer, episodic ataxia, ataxia, leukemia, prostatitis, and neuronitis. This protein has also been shown to involve MAPK1, MAPK14, MAPK3, MAPK7, and CDH2 in MAPK signaling pathway, EGFR1 Signaling Pathway, Signal transduction Erk Interactions- Inhibition of Erky, and Epithelial Adherens Junctions pathways.

Alternate Names

Ch-1 PTPase, ch-1PTPase, DKFZp781C1038, EC 3.1.3.48, ECPTP, EC-PTP, FLJ34328, MGC131968, MGC148170, NC-PTPCOM1, PCPTP1, protein tyrosine phosphatase Cr1PTPase, protein tyrosine phosphatase, receptor type, R, protein-tyrosine phosphatase NC-PTPCOM1, Protein-tyrosine phosphatase PCPTP1, PTPBR7, PTPRQ, PTP-SL, receptor-type tyrosine-protein phosphatase R, R-PTP-R

Gene Symbol

PTPRR

Additional PCPTP1 Products

Product Documents for PCPTP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCPTP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCPTP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCPTP1 Antibody - BSA Free and earn rewards!

Have you used PCPTP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...