PHF22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58977

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSSVTSGLTGWAAFAAKTSSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGSNNSTT

Reactivity Notes

Mouse 88%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PHF22 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PHF22 Antibody [NBP2-58977]

Immunocytochemistry/ Immunofluorescence: PHF22 Antibody [NBP2-58977]

Immunocytochemistry/Immunofluorescence: PHF22 Antibody [NBP2-58977] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
PHF22 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: PHF22 Antibody - BSA Free [NBP2-58977]

Chromatin Immunoprecipitation-exo-Seq: PHF22 Antibody - BSA Free [NBP2-58977]

ChIP-Exo-Seq composite graph for Anti-INTS12 (NBP2-58977) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for PHF22 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHF22

INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM]

Alternate Names

Int12, integrator complex subunit 12, PHD finger protein 22INT12, PHF22, SBBI22

Gene Symbol

INTS12

Additional PHF22 Products

Product Documents for PHF22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHF22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHF22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHF22 Antibody - BSA Free and earn rewards!

Have you used PHF22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...