PI 3-Kinase p55 gamma Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-58332
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
PI 3-Kinase p55 gamma Antibody is made to synthetic peptides corresponding to PIK3R3(phosphoinositide-3-kinase, regulatory subunit 3 (gamma)) The peptide sequence was selected from the middle region of PIK3R3. Peptide sequence EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE. The peptide sequence for this immunogen was taken from within the described region.
Specificity
PI 3-Kinase p55 gamma Antibody is specific to Subunit or Isoform: gamma.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for PI 3-Kinase p55 gamma Antibody - BSA Free
Western Blot: PI 3-Kinase p55 gamma Antibody [NBP1-58332]
Western Blot: PIK3R3 Antibody [NBP1-58332] - Transfected 293T cell lysate, concentration 5.0 ug/ml.Applications for PI 3-Kinase p55 gamma Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PI 3-Kinase p55 gamma
References
1. Backer J. M. (2010). The regulation of class IA PI 3-kinases by inter-subunit interactions. Current Topics in Microbiology and Immunology. https://doi.org/10.1007/82_2010_52
2. Hirsch, E., Costa, C., & Ciraolo, E. (2007). Phosphoinositide 3-kinases as a common platform for multi-hormone signaling. The Journal of Endocrinology. https://doi.org/10.1677/JOE-07-0097
3. Uniprot (Q92569)
4. Yang, J., Nie, J., Ma, X., Wei, Y., Peng, Y., & Wei, X. (2019). Targeting PI3K in cancer: mechanisms and advances in clinical trials. Molecular Cancer. https://doi.org/10.1186/s12943-019-0954-x
5. Seo, M., Kim, J. H., & Suk, K. (2017). Role of the p55-gamma subunit of PI3K in ALK-induced cell migration: RNAi-based selection of cell migration regulators. Cell Adhesion & Migration. https://doi.org/10.1080/19336918.2016.1202385
Long Name
PI 3-Kinase p55 gamma
Alternate Names
p55PIK, PI 3Kinase p55 gamma, PIK3R3
Gene Symbol
PIK3R3
UniProt
Additional PI 3-Kinase p55 gamma Products
Product Documents for PI 3-Kinase p55 gamma Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PI 3-Kinase p55 gamma Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PI 3-Kinase p55 gamma Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PI 3-Kinase p55 gamma Antibody - BSA Free and earn rewards!
Have you used PI 3-Kinase p55 gamma Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
IL-2 Signaling Pathways
IL-4 Signaling Pathways
IL-7 Signaling Pathways
IL-9 Signaling Pathways
IL-15 Signaling Pathways
IL-21 Signaling Pathways
TGF-beta Signaling Pathways
VEGF - VEGF R2 Signaling Pathways