PSD93 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58558

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI

Reactivity Notes

Mouse 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSD93 Antibody - BSA Free

Western Blot: PSD93 Antibody [NBP2-58558]

Western Blot: PSD93 Antibody [NBP2-58558]

Western Blot: PSD93 Antibody [NBP2-58558] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: PSD93 Antibody [NBP2-58558]

Immunocytochemistry/ Immunofluorescence: PSD93 Antibody [NBP2-58558]

Immunocytochemistry/Immunofluorescence: PSD93 Antibody [NBP2-58558] - Staining of human cell line CACO-2 shows localization to plasma membrane. Antibody staining is shown in green.

Applications for PSD93 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSD93

Post Synaptic Density 93 (PSD 93), also known as chapsyn-110, is one of a family of plasma membrane-associated proteins found in synaptic junctions. PSD 93 is unique among family members in its expression in Purkinje neuron cell bodies and dendrites. PSD 93 has three ~90 amino acid repeats called PDZ domains, a single interior SH3 domain, and a carboxyl-terminal guanylate kinase homology (GuK) domain that is enzymatically inactive. It is hypothesized that PDZ-domain interactions play a role in receptor and channel clustering which contributes to neuronal plasticity.PSD 93 is believed to participate in the clustering of certain proteins, including N-methyl-D-aspartate (NMDA) receptors and shaker-type potassium channels at the synaptic membrane. There are two principal modes of interaction between PSD 93 and other proteins. NMDA receptors and shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif (beta 1 adrenergic receptor, some serotonin receptors, some sodium channel subunits, and additional potassium channel subunits) may interact with PSD 93 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with PSD 93 in vitro through a pseudo-homotypic PDZ-PDZ interaction.

Alternate Names

Chapsyn-110, discs, large homolog 2 (Drosophila), discs, large homolog 2, chapsyn-110, discs, large homolog 2, chapsyn-110 (Drosophila), disks large homolog 2, DKFZp781D1854, DKFZp781E0954, FLJ37266, MGC131811, Postsynaptic density protein PSD-93, PSD-93, PSD93,110kDa

Gene Symbol

DLG2

Additional PSD93 Products

Product Documents for PSD93 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSD93 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PSD93 Antibody - BSA Free

Customer Reviews for PSD93 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSD93 Antibody - BSA Free and earn rewards!

Have you used PSD93 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...