PUM1 Antibody (8Y6H5)

Novus Biologicals | Catalog # NBP3-15279

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8Y6H5 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human PUM1 (Q14671). NNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PUM1 Antibody (8Y6H5)

Western Blot: PUM1 Antibody (8Y6H5) [NBP3-15279]

Western Blot: PUM1 Antibody (8Y6H5) [NBP3-15279]

Western Blot: PUM1 Antibody (8Y6H5) [NBP3-15279] - Western blot analysis of extracts of various cell lines, using PUM1 Rabbit mAb (NBP3-15279) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
PUM1 Antibody (8Y6H5)

Immunocytochemistry/ Immunofluorescence: PUM1 Antibody (8Y6H5) [NBP3-15279] -

Immunocytochemistry/ Immunofluorescence: PUM1 Antibody (8Y6H5) [NBP3-15279] - Immunofluorescence analysis of U-2 OS cells using PUM1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for PUM1 Antibody (8Y6H5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PUM1

Pumilio-1 encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Long Name

Pumilio 1

Alternate Names

HSPUM, PUMH1, Pumilio-1, PUML1

Gene Symbol

PUM1

Additional PUM1 Products

Product Documents for PUM1 Antibody (8Y6H5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PUM1 Antibody (8Y6H5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PUM1 Antibody (8Y6H5)

There are currently no reviews for this product. Be the first to review PUM1 Antibody (8Y6H5) and earn rewards!

Have you used PUM1 Antibody (8Y6H5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...