RAB35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79484

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human RAB35. Peptide sequence: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB35 Antibody - BSA Free

Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484] - Human heart cell lysate.
Immunocytochemistry/ Immunofluorescence: RAB35 Antibody [NBP1-79484]

Immunocytochemistry/ Immunofluorescence: RAB35 Antibody [NBP1-79484]

Immunocytochemistry/Immunofluorescence: RAB35 Antibody [NBP1-79484] - Human dorsal root ganglion neurons. Dual ICC stain RAB35 in green, NF200 in red. Note axons are out of view, this is a Z-stack section. RAB35 antibody at 1:500. Strong plasma membrane binding which is consistent with tagged construct expression. Some non-specific binding in the nucleus/nucleolus which may improve with lowered antibody concentrations. Primary incubation overnight at 4C, secondary antibodies (Alexa 488 and 546) at room temperature. ICC/IF image submitted by a verified customer review.
Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484]

Western Blot: RAB35 Antibody [NBP1-79484] - HeLa cells, HEK293T cells. Antibody at 1:500.

Applications for RAB35 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
This RAB35 antibody is validated for ICC/IF from a verified customer review.

Reviewed Applications

Read 1 review rated 4 using NBP1-79484 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB35

Possesses GTPase activity

Alternate Names

GTP-binding protein RAY, H-ray, RAB1C, RAB35, member RAS oncogene family, Ras-related protein Rab-1C, ras-related protein rab-1c (GTP-binding protein ray), ras-related protein Rab-35, RAY

Gene Symbol

RAB35

Additional RAB35 Products

Product Documents for RAB35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB35 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used RAB35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • RAB35 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: Dorsal root ganglion neurons
    Species: Human
    Verified Customer | Posted 12/22/2019
    Dual ICC stain RAB35 in green, NF200 in red. Note axons are out of view, this is a Z-stack section. Strong PM binding.
    This antibody is only listed as verified in WB so I decide to test it in ICC. I used it at 1:500, originally tried 1:300 but that was too high - I think the concentration could even be dropped to 1:1000, this may improve it's specificity. There was strong plasma membrane binding which is consistent with tagged construct expression. Some non-specific binding in the nucleus/ nucleolus which may improve with lowered antibody concentrations. Primary incubation was performed overnight at 4C, secondary antibodies (Alexa 488 and 546) at room temperature.
    RAB35 Antibody - BSA Free NBP1-79484
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...