Rad23 is an evolutionarily conserved protein that is important for nucleotide excision repair. All eukaryotic Rad23 proteins contain an amino-terminal UbL domain that bears a striking resemblance to ubiquitin. Rad23 has a proteolytic function in DNA repair via its interaction with the 26S proteosome through the UbL domain. The elimination of this Rad23 domain causes sensitivity to ultraviolet radiation.
Rad23 Antibody (3B7T9)
Novus Biologicals | Catalog # NBP3-16573
Recombinant Monoclonal Antibody
![Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573]](https://resources.rndsystems.com/images/products/Rad23-Antibody-3B7T9-Western-Blot-NBP3-16573-img0003.jpg "Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 3B7T9 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Rad23 (P54725). TGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Rad23 Antibody (3B7T9)
Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573]
Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573] - Western blot analysis of extracts of various cell lines, using Rad23 Rabbit mAb (NBP3-16573) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.![Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573]](https://resources.rndsystems.com/images/products/Rad23-Antibody-3B7T9-Immunocytochemistry-Immunofluorescence-NBP3-16573-img0002.jpg "Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573]")
Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573]
Immunocytochemistry/Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573] - Immunofluorescence analysis of U-2 OS cells using Rad23 Rabbit mAb (NBP3-16573) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.![Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573]](https://resources.rndsystems.com/images/products/Rad23-Antibody-3B7T9-Western-Blot-NBP3-16573-img0004.jpg "Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573]")
Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573]
Western Blot: Rad23 Antibody (3B7T9) [NBP3-16573] - Western blot analysis of extracts of various cell lines, using Rad23 Rabbit mAb (NBP3-16573) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.![Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573]](https://resources.rndsystems.com/images/products/Rad23-Antibody-3B7T9-Immunocytochemistry-Immunofluorescence-NBP3-16573-img0001.jpg "Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573]")
Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573]
Immunocytochemistry/Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573] - Immunofluorescence analysis of NIH-3T3 cells using Rad23 Rabbit mAb (NBP3-16573) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573] -
Immunocytochemistry/ Immunofluorescence: Rad23 Antibody (3B7T9) [NBP3-16573] - Immunofluorescence analysis of NIH-3T3 cells using Rad23 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for Rad23 Antibody (3B7T9)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Rad23
Alternate Names
hHR23
Gene Symbol
RAD23A
Additional Rad23 Products
Product Documents for Rad23 Antibody (3B7T9)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Rad23 Antibody (3B7T9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Rad23 Antibody (3B7T9)
There are currently no reviews for this product. Be the first to review Rad23 Antibody (3B7T9) and earn rewards!
Have you used Rad23 Antibody (3B7T9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...