Rad51L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55046

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rad51L1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Rad51L1 Antibody [NBP2-55046]

Immunocytochemistry/ Immunofluorescence: Rad51L1 Antibody [NBP2-55046]

Immunocytochemistry/Immunofluorescence: Rad51L1 Antibody [NBP2-55046] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
Rad51L1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: Rad51L1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: Rad51L1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-Rad51L1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for Rad51L1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rad51L1

The Rad51 DNA repair protein is a key component of the double-strand break repair pathway and is essential for mitotic and meiotic recombination and genomic stability. Five human RAD51 homologues have been identified: XRCC2, XRCC3, RAD51B, RAD51C, and RAD51D. Each of these homologues interacts with one or more of the others, with all of the proteins involved with one complex or with multiple smaller complexes. Rad51B plays a role in meiotic recombination and/or recombinational repair.

Alternate Names

DNA repair protein RAD51 homolog 2, MGC34245, R51H2REC2hREC2, RAD51 (S. cerevisiae)-like 1, RAD51 homolog B, RAD51B, RAD51-like 1 (S. cerevisiae), RAD51-like protein 1, RecA-like protein, recombination repair protein

Gene Symbol

RAD51B

Additional Rad51L1 Products

Product Documents for Rad51L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rad51L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rad51L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rad51L1 Antibody - BSA Free and earn rewards!

Have you used Rad51L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...