RAMP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58104

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAMP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit RAMP2 Antibody - BSA Free (NBP2-58104) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RAMP2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RAMP2 Antibody [NBP2-58104]

Immunocytochemistry/ Immunofluorescence: RAMP2 Antibody [NBP2-58104]

Immunocytochemistry/Immunofluorescence: RAMP2 Antibody [NBP2-58104] - Staining of human cell line SH-SY5Y shows localization to vesicles.

Applications for RAMP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAMP2

The protein encoded by the RAMP2 gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface.

Long Name

Receptor Activity Modifying Protein 2

Alternate Names

calcitonin receptor-like receptor activity modifying protein 2, Calcitonin-receptor-like receptor activity-modifying protein 2, CRLR activity-modifying protein 2, receptor (calcitonin) activity modifying protein 2, receptor (G protein-coupled) activity modifying protein 2, receptor activity modifying protein 2, receptor activity-modifying protein 2, receptor-activity-modifying protein 2

Gene Symbol

RAMP2

Additional RAMP2 Products

Product Documents for RAMP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAMP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAMP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAMP2 Antibody - BSA Free and earn rewards!

Have you used RAMP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies