retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17534

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all retinol dehydrogenase 8 (all trans) Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: retinol dehydrogenase 8 (all trans) Antibody [NBP3-17534]

Immunocytochemistry/ Immunofluorescence: retinol dehydrogenase 8 (all trans) Antibody [NBP3-17534]

Immunocytochemistry/Immunofluorescence: retinol dehydrogenase 8 (all trans) Antibody [NBP3-17534] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm, cytosol & midbody ring.

Applications for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: retinol dehydrogenase 8 (all trans)

All-trans-retinol dehydrogenase (RDH8) is a visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol in the presence of NADPH (Rattner et al., 2000 [PubMed 10753906]). It is a member of the short chain dehydrogenase/reductase family and is located in the outer segments of photoreceptors; hence it is also known as photoreceptor retinol dehydrogenase. It is important in the visual cycle by beginning the rhodopsin regeneration pathway by reducing all-trans-retinal, the product of bleached and hydrolysed rhodopsin (Rando, 2001 [PubMed 11710234]). This is a rate-limiting step in the visual cycle (Saari et al., 1998 [PubMed 9667000]).[supplied by OMIM]

Alternate Names

photoreceptor outer segment all-trans retinol dehydrogenase, PRRDH, retinol dehydrogenase 8, retinol dehydrogenase 8 (all-trans), SDR28C2, short chain dehydrogenase/reductase family 28C, member 2

Gene Symbol

RDH8

Additional retinol dehydrogenase 8 (all trans) Products

Product Documents for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review retinol dehydrogenase 8 (all trans) Antibody - BSA Free and earn rewards!

Have you used retinol dehydrogenase 8 (all trans) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies