RFX5 Antibody [Biotin]

Name: RFX5 Antibody [Biotin]
Brand: Novus Biologicals
SKU: NBP3-80443
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-80443

Submit a review

Product Documents

Fc Region Site-Specific Biotinylated Antibody

View Available Formulations

100% Guarantee

Product Specifications
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation, Chromatin Immunoprecipitation-exo-Seq

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG

View all RFX5 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein RFX5 using the following amino acid sequence: TVSKGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for RFX5 Antibody [Biotin]

Application

Recommended Usage

Chromatin Immunoprecipitation

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Application Notes

Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP3-25102

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: RFX5

RFX5 is the regulatory gene responsible for human MHC class II deficiency. Patients with this disease exhibit a characteristic defect in the binding of a nuclear factor, RFX, to the X box motif of MHC class II promoters. RFX5 is the 75 kDa subunit of the RFX complex which is absolutely essential and highly specific for regulating MHC class II gene expression and control of the immune response. RFX5 is a protein consisting of 616 amino acids.

Alternate Names

DNA-binding protein RFX5, Regulatory factor X 5, regulatory factor X, 5 (influences HLA class II expression)

Gene Symbol

RFX5

Additional RFX5 Products

Product Documents for RFX5 Antibody [Biotin]

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RFX5 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RFX5 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review RFX5 Antibody [Biotin] and earn rewards!

Have you used RFX5 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image