RNA polymerase I termination factor Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03880

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 806-905 of human RNA polymerase I termination factor (NP_031370.2). RLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLEKMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQGRWII

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RNA polymerase I termination factor Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: RNA polymerase I termination factor Antibody - Azide and BSA Free [NBP3-03880]

Immunocytochemistry/ Immunofluorescence: RNA polymerase I termination factor Antibody - Azide and BSA Free [NBP3-03880]

Immunocytochemistry/Immunofluorescence: RNA polymerase I termination factor Antibody [NBP3-03880] - Analysis of U-2 OS cells using RNA polymerase I termination factor antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for RNA polymerase I termination factor Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RNA polymerase I termination factor

The TTF1 gene encodes a 905 amino acid long, 103 kDA transcription termination factor 1 protein, also known as a RNA polymerase I termination factor, which functions in terminating ribosomal gene transcription. Additionally, it regulates fork arrest replication and RNA polymerase I transcription on chromatin. Through monitoring the activation as well as the silencing of rDNA transcription, TTF1 acts in rDNA regulation. TTF1 functions in RNA polymerase I transcription as well as mitochondrial transcription and gene expression. It is known to interact with genes PTRF, NFATC3, BAZ2A, SMAD1, and SMAD7. TTF1 has been researched regarding its role in lung cancer, small cell carcinoma, sex cord-gonadal stromal tumor, thyroiditis, blastoma, adenocarcinoma, desmoplastic small round cell tumors, and hirschsprung's disease.

Alternate Names

RNA polymerase I termination factor, transcription termination factor 1, Transcription termination factor I, transcription termination factor, RNA polymerase I, TTF-1, TTF-I

Gene Symbol

TTF1

Additional RNA polymerase I termination factor Products

Product Documents for RNA polymerase I termination factor Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNA polymerase I termination factor Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for RNA polymerase I termination factor Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RNA polymerase I termination factor Antibody - Azide and BSA Free and earn rewards!

Have you used RNA polymerase I termination factor Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...