ROR gamma/RORC/NR1F3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56610

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV

Reactivity Notes

Mouse 87%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ROR gamma/RORC/NR1F3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ROR gamma/RORC/NR1F3 Antibody [NBP2-56610]

Immunocytochemistry/ Immunofluorescence: ROR gamma/RORC/NR1F3 Antibody [NBP2-56610]

Immunocytochemistry/Immunofluorescence: ROR gamma/RORC/NR1F3 Antibody [NBP2-56610] - Staining of human cell line HeLa shows localization to nuclear bodies.
ROR gamma/RORC/NR1F3 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ROR gamma/RORC/NR1F3 Antibody - BSA Free [NBP2-56610]

Chromatin Immunoprecipitation-exo-Seq: ROR gamma/RORC/NR1F3 Antibody - BSA Free [NBP2-56610]

ChIP-Exo-Seq composite graph for Anti-RORC (NBP2-56610) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ROR gamma/RORC/NR1F3 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ROR gamma/RORC/NR1F3

ROR gamma/RORC/NR1F3, aka RAR Orphan Receptor gamma, is a Nuclear Receptor 1 Thyroid Hormone-Like receptor containing a short A-T rich sequence follow by a single core motif half-site 5'-AGGTCA-3'. RORC is a key regulator of thymopoiesis, bone metabolism, T-cell apoptosis, and lymphoid organogenesis. NR1F3 regulates intrinsic transcriptional functions. Unlike other major nuclear receptors, RORC binds as a monomer to hormone response elements and is documented in mouse thymus, adipose, bone, skeletal muscle, liver, kidney, and human skeletal muscle. An N-terminal isoform of ROR gamma, ROR gamma T, inhibits Fas ligand expression and cytokine secretion in immature thymocytes.

Long Name

Retinoic Acid-Related Orphan Receptor gamma

Alternate Names

NR1F3, RORC, RZRG

Gene Symbol

RORC

Additional ROR gamma/RORC/NR1F3 Products

Product Documents for ROR gamma/RORC/NR1F3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ROR gamma/RORC/NR1F3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ROR gamma/RORC/NR1F3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ROR gamma/RORC/NR1F3 Antibody - BSA Free and earn rewards!

Have you used ROR gamma/RORC/NR1F3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for ROR gamma/RORC/NR1F3 Antibody - BSA Free

Showing  1 - 2 的 2 FAQs Showing All
  • Q: Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?

    A: Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.

  • Q: What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?

    A: The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

  • Q: Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?

    A: Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.

  • Q: What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?

    A: The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

Showing  1 - 2 的 2 FAQs Showing All
View all FAQs for Antibodies
Loading...