SCN4A Antibody

Novus Biologicals | Catalog # NBP2-30861

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG
View all SCN4A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCN4A Antibody

SCN4A Antibody Immunocytochemistry/ Immunofluorescence: SCN4A Antibody [NBP2-30861]

Immunocytochemistry/ Immunofluorescence: SCN4A Antibody [NBP2-30861]

Staining of human cell line U-2 OS shows localization to nucleoplasm & microtubule organizing center.

Applications for SCN4A Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCN4A

SCN4A is a member of the sodium channel alpha subunit family and mediates the voltage-dependent sodium ion permeability of excitable membranes. It assumes opened or closed conformations in response to the voltage difference across the membrane; the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. This sodium channel may be present in both denervated and innervated skeletal muscle.

Alternate Names

HOKPP2, HYKPP, HYPP, Na(V)1.4, NAC1A, Nav1.4, skeletal muscle voltage-dependent sodium channel type IV alpha subunit, SkM1, sodium channel protein skeletal muscle subunit alpha, sodium channel protein type 4 subunit alpha, sodium channel protein type IV subunit alpha, sodium channel, voltage-gated, type IV, alpha subunit, voltage-gated sodium channel subunit alpha Nav1.4

Gene Symbol

SCN4A

UniProt

P35499 (Human)

Additional SCN4A Products

Product Documents for SCN4A Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SCN4A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCN4A Antibody

There are currently no reviews for this product. Be the first to review SCN4A Antibody and earn rewards!

Have you used SCN4A Antibody?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies