Septin-12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91640

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Septin-12 Antibody - BSA Free

Western Blot: Septin-12 Antibody [NBP1-91640]

Western Blot: Septin-12 Antibody [NBP1-91640]

Western Blot: Septin-12 Antibody [NBP1-91640] - Analysis in control (vector only transfected HEK293T lysate) and LY408232 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Septin-12 Antibody [NBP1-91640]

Immunocytochemistry/ Immunofluorescence: Septin-12 Antibody [NBP1-91640]

Immunocytochemistry/Immunofluorescence: Septin-12 Antibody [NBP1-91640] - Staining of human cell line U-2 OS shows localization to microtubules. Antibody staining is shown in green.

Applications for Septin-12 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Septin-12

Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia (Hall et al., 2005 [PubMed 15915442]).[supplied by OMIM]

Alternate Names

FLJ25410, septin 12, septin-12

Gene Symbol

SEPTIN12

Additional Septin-12 Products

Product Documents for Septin-12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Septin-12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Septin-12 Antibody - BSA Free

Customer Reviews for Septin-12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Septin-12 Antibody - BSA Free and earn rewards!

Have you used Septin-12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Septin-12 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I'm interested in Septin-12 Antibody (NBP1-91640) for IHC-P. I wonder if 1:500 works well on IHC-P, taking into consideration of dilution factor for ICC and IHC.

    A: Septin-12 is widely expressed in various normal and cancerous tissues, however, its expression levels vary from tissue to tissue. For example, its highest expression levels are seen in lymph node, colon, heart, testes, placenta etc. whereas weak to moderate expression may be seen in liver, brain, bronchus, skin etc. Its expression is negligible in spleen, ovary and breasts, and this is the reason you see a wide range of dilutions being suggested for different applications which also have different levels of sensitivity with respect to detection of a given target. In our validation testing for IHC-P staining of human stomach, this antibody worked well at a dilution of 1:500-1:1000 range, however, we suggest you to optimize the best suitable dilution for your assay from your own pilot testing.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...