SETMAR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58313

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SETMAR Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SETMAR Antibody - BSA Free

Western Blot: SETMAR Antibody [NBP2-58313]

Western Blot: SETMAR Antibody [NBP2-58313]

Western Blot: SETMAR Antibody [NBP2-58313] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SETMAR Antibody [NBP2-58313]

Immunocytochemistry/ Immunofluorescence: SETMAR Antibody [NBP2-58313]

Immunocytochemistry/Immunofluorescence: SETMAR Antibody [NBP2-58313] - Staining of human cell line MCF7 shows localization to nucleoli.

Applications for SETMAR Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SETMAR

Histone methyltransferase that methylates 'Lys-4' and 'Lys-36' of histone H3, 2 specific tags for epigenetic transcriptional activation. Specifically mediates dimethylation of H3 'Lys-36'. Has sequence-specific DNA-binding activity and recognizes the 19-mer core of the 5'-terminal inverted repeats (TIRs) of the Hsmar1 element. Has DNA nicking activity. Has in vivo end joining activity and may mediate genomic integration of foreign DNA

Alternate Names

EC 2.1.1.43, histone-lysine N-methyltransferase SETMAR, hsMar1, Metnase, SET domain and mariner transposase fusion gene, SET domain and mariner transposase fusion gene-containing protein

Gene Symbol

SETMAR

Additional SETMAR Products

Product Documents for SETMAR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SETMAR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SETMAR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SETMAR Antibody - BSA Free and earn rewards!

Have you used SETMAR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies